Protein Info for SMc02085 in Sinorhizobium meliloti 1021

Annotation: biopolymer transport transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 97 to 120 (24 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 87 to 299 (213 residues), 328.8 bits, see alignment E=8.2e-103 PF01618: MotA_ExbB" amino acids 186 to 279 (94 residues), 101.9 bits, see alignment E=1.1e-33

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to smk:Sinme_1313)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q41 at UniProt or InterPro

Protein Sequence (328 amino acids)

>SMc02085 biopolymer transport transmembrane protein (Sinorhizobium meliloti 1021)
MSDRIRPKLNVLLAATLAVFLAGPVANGLAQTVQQPSSVSVDAQPPATDVPGADDPGAQP
APLEAAAGDATAGDATEVNPVLPHDLSPVGMFLAADIVVKAVMVALALASVATWAIFLVK
TLELIYAKSRLKRAVAALVSANGLAEVQSKLERRAGVAGEMVAAAIDEMTRSEAVLDLAP
AVGVKERVSSLLTRIEVRAGKRMSAGTGILASIGSVGPFVGLFGTVWGIMNSFIGISKAQ
TTNLAIVAPGIAEALLATAIGLVAAIPAVVIYNYFARSVGGYKLILADAAAAVERLVSRD
LDHRHARRAPPRRQDGFAHAPDSIARIG