Protein Info for SMc02076 in Sinorhizobium meliloti 1021

Annotation: cardiolipin synthetase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 59 (22 residues), see Phobius details PF13091: PLDc_2" amino acids 137 to 244 (108 residues), 49.3 bits, see alignment E=6.8e-17 amino acids 331 to 447 (117 residues), 92.5 bits, see alignment E=2.9e-30 PF00614: PLDc" amino acids 402 to 427 (26 residues), 37.7 bits, see alignment (E = 2.1e-13)

Best Hits

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 100% identity to smk:Sinme_1322)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q34 at UniProt or InterPro

Protein Sequence (487 amino acids)

>SMc02076 cardiolipin synthetase transmembrane protein (Sinorhizobium meliloti 1021)
MIVFIESYWPHFLALLSVVLGVPAIIHAAMTKDDVRAAAGWVGVVLLSPVIGAVIYAVAG
INRMRRSSIGLQRSLLRSTERDPFGRFDVTHDQVVARFGQRFAAMKMLGDRVARFTMSAG
NHITMLEGGDAVYAAMLDEISSARRSILIESYIFDRDPIGMRFADALIAAVKRGVAVRVL
IDAVGARYSVPSIVGYLKEGGVPTAVFNGNIIMGLRLPYANLRTHRKIMVVDGAVAFAGG
MNIRAGFAAEIAGKAASFDTHFRVTGPVVADIFQVAAEDWQFSSKEVLTGDGWRLADLPA
EPDGRSVLMRAVPSGPDNTNETNHKMLMGAFSMARKHIRLMSPYFLPDKELVSALVTAAR
KGVEVDIVVPSVNNLTLVDRAMTAQFDQVLKGHCRVWRAKGAFNHSKLMVIDDRWAYVGS
TNLDPRSLRLNFEFDLEILDEAFARAIGEKVCAIRAAADEVTLAGLRAQPLVNRLANRLL
WLGSPYL