Protein Info for SMc02073 in Sinorhizobium meliloti 1021

Annotation: arginyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 TIGR00456: arginine--tRNA ligase" amino acids 13 to 584 (572 residues), 361.4 bits, see alignment E=3.9e-112 PF03485: Arg_tRNA_synt_N" amino acids 25 to 94 (70 residues), 70.4 bits, see alignment E=4.9e-23 PF00750: tRNA-synt_1d" amino acids 119 to 179 (61 residues), 46 bits, see alignment E=1.2e-15 amino acids 314 to 417 (104 residues), 23.6 bits, see alignment E=7.4e-09 PF05746: DALR_1" amino acids 454 to 584 (131 residues), 103.5 bits, see alignment E=2.3e-33

Best Hits

Swiss-Prot: 100% identical to SYR_RHIME: Arginine--tRNA ligase (argS) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01887, arginyl-tRNA synthetase [EC: 6.1.1.19] (inferred from 100% identity to smk:Sinme_1325)

Predicted SEED Role

"Arginyl-tRNA synthetase (EC 6.1.1.19)" (EC 6.1.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q31 at UniProt or InterPro

Protein Sequence (585 amino acids)

>SMc02073 arginyl-tRNA synthetase (Sinorhizobium meliloti 1021)
MNLFTDFEARINRILESIEIIREKRSELDFGRINVEPPRDASHGDVATNAAMVLAKPLGM
NPRALADLIVDKLGQDPEVAGVSVAGPGFINVRLSVSYWQKLLAAITRAGVDYGRSTFGA
GRKINVEYVSANPTGPMHVGHCRGAVVGDALANLLAFAGYDVTKEYYINDAGSQIEVLAR
SAFLRYRQALGEDIAEIPAGLYPGDYLVPVGEALADEYGTSLRIMPEDKWVPLVKERVID
AMMAMIREDLAALNVNHDVFFSERALHDNGAARIRTAINDLTFKGHVYKGTLPPPKGQLP
EDWEDREQTLFRSTEVGDDIDRPLIKSDGSYTYFAADVAYFKDKFDRGFHEMIYVLGADH
GGYVKRLEALARAISGGTAKLTVLLCQLVKLYRNGEPVKMSKRSGDFVTLRDVVDEVGRD
PVRFMMLYRKSSEPLDFDFAKVTEQSKDNPVFYVQYAHARCRSVFRQAAEAFPDLDLSSV
DFAAAAGAIVDPTEMQLVAKLAEYPRVVEAAALSHEPHRIAFYLYDLAAVFHGHWNKGKE
NPELRFVNDKNRELSIARLGLVHAVASVLKSGLSITGTSAPDEMR