Protein Info for SMc02067 in Sinorhizobium meliloti 1021

Annotation: twin arginine translocase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01411: twin arginine-targeting protein translocase, TatA/E family
  • amino acids 3 to 47 (45 residues), 76.8 bits, E=3.5e-26
• PF02416: TatA_B_E
  • amino acids 4 to 45 (42 residues), 56.9 bits, E=6.1e-20

Best Hits

Swiss-Prot: 100% identical to TATA_RHIME: Sec-independent protein translocase protein TatA (tatA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03116, sec-independent protein translocase protein TatA (inferred from 98% identity to smk:Sinme_1331)

MetaCyc: 44% identical to twin arginine protein translocation system - TatE protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatA" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

See Q92Q25 at UniProt or InterPro

Protein Sequence (68 amino acids)

>SMc02067 twin arginine translocase A (Sinorhizobium meliloti 1021)
MGSFSIWHWLIVLAVVLLLFGRGKIPELMGDVAKGIKNFKKGMGDDEVASADKSVDGKTV
DHKSDEVR