Protein Info for SMc02064 in Sinorhizobium meliloti 1021

Annotation: seryl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to SYS_RHIME: Serine--tRNA ligase (serS) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01875, seryl-tRNA synthetase [EC: 6.1.1.11] (inferred from 100% identity to smk:Sinme_1334)

Predicted SEED Role

"Seryl-tRNA synthetase (EC 6.1.1.11)" in subsystem Glycine and Serine Utilization (EC 6.1.1.11)

MetaCyc Pathways

tRNA charging (19/21 steps found)
L-selenocysteine biosynthesis I (bacteria) (3/3 steps found)
L-selenocysteine biosynthesis II (archaea and eukaryotes) (2/4 steps found)
shinorine biosynthesis (3/8 steps found)
vanchrobactin biosynthesis (2/8 steps found)
enterobactin biosynthesis (4/11 steps found)
superpathway of chorismate metabolism (38/59 steps found)
colibactin biosynthesis (6/38 steps found)

KEGG Metabolic Maps

Aminoacyl-tRNA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q22 at UniProt or InterPro

Protein Sequence (427 amino acids)

>SMc02064 seryl-tRNA synthetase (Sinorhizobium meliloti 1021)
MLDIKWIRENADALDEALAKRGAEPLSASLIALDERRRAVLQSLQDMQSRRNAASKEIGA
AMAQKNSELADRLKAEVADLKNALPAAEEESRRIEAELSDALSRIPNTPLADVPVGADES
ANVVTRVVGAKPGWNHKPLEHFEIGEALGLMDFEGAARIAGSRFTILKGQLARLERALGQ
FMLDLHTGEHGYIEVQPPLLVRDDAMYGTGQLPKFSDDLFRTTDGRWLIPTAEVPLTNMV
REQILDGEKLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFNKVELVSITDAESSIDEHE
RMTACAEEVLKRLGLHYRVMTLCTGDMGFGARKTYDLEVWLPGQDAYREISSCSVCGDFQ
ARRMNARYRGKEEKGTKFVHTLNGSGVALGRALIAVIENYLNDDGSITVPDVLVPYMGGL
RRIEKSA