Protein Info for SMc02060 in Sinorhizobium meliloti 1021

Annotation: lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF01476: LysM" amino acids 167 to 209 (43 residues), 46.5 bits, see alignment 2.8e-16 amino acids 282 to 324 (43 residues), 58 bits, see alignment 7.1e-20 PF01551: Peptidase_M23" amino acids 413 to 507 (95 residues), 103.2 bits, see alignment E=7.2e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_1338)

Predicted SEED Role

"Lipoprotein NlpD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q926D2 at UniProt or InterPro

Protein Sequence (512 amino acids)

>SMc02060 lipoprotein (Sinorhizobium meliloti 1021)
MRKFVSPQAGKSVIRLCAAILLAGVATGCSSDASRFGGLFSRSDDIMTGSIPQGSSTVPR
GDVASGGAAPSYGNSAALGQSYPSGDGNGGYNTAAAPVSSARVASTPMSVQRTSLDEPSA
ASRQPQVQTASLESQAAALPKAEPLAGAAKDMSGKGGWSASNAPTIMVRQGDTVTVLARR
FGVPEKEILKANGLKSASQVEPGQRLVIPTFGTAGSAAKAAASGSIADVEGGKKRPSPLP
TDQREVAILPGQSQSREKSESRSDVAAGKLNSAGEGGGNGAYTVKPGDSLNRIAKANGVS
VAALKQANGLSTEAIRIGQKLNIPSASAKTPATDAVVTASVSAKKNEAQAASTEQGKLTE
TKAPAAKESVSEVAIRSDGNEDLPKSTGIGKYRWPVRGAVVAAYGANVDGNRNDGINISV
PEGTPIKAAENGVVIYSGSSLKELGNAVLVRHDDGTVTVYGNAAELKVQRGQKVQRGQTL
ASSGMTGRATRPQVHFEVRKNATPVNPATYLE