Protein Info for SMc02043 in Sinorhizobium meliloti 1021
Annotation: KHG/KDPG aldolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 41% identical to ALKD_PSEAE: 2-dehydro-3-deoxy-phosphogluconate aldolase (eda) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 100% identity to sme:SMc02043)Predicted SEED Role
No annotation
MetaCyc Pathways
- superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
- Entner-Doudoroff pathway I (8/9 steps found)
- 4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
- D-fructuronate degradation (4/4 steps found)
- superpathway of β-D-glucuronosides degradation (6/7 steps found)
- superpathway of hexuronide and hexuronate degradation (8/10 steps found)
- Entner-Doudoroff shunt (2/2 steps found)
- Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
- D-galacturonate degradation I (4/5 steps found)
- trans-4-hydroxy-L-proline degradation I (3/5 steps found)
- 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
- D-glucosaminate degradation (1/3 steps found)
- superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)
KEGG Metabolic Maps
- Arginine and proline metabolism
- Glyoxylate and dicarboxylate metabolism
- Pentose and glucuronate interconversions
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 4.1.2.14, 4.1.3.16
Use Curated BLAST to search for 4.1.2.14 or 4.1.3.16
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92MQ7 at UniProt or InterPro
Protein Sequence (217 amino acids)
>SMc02043 KHG/KDPG aldolase (Sinorhizobium meliloti 1021) MIAPFDQAATLGVVPVIAIERSSDAVALADALLEGGLPLAEITFRTEAAAEVIAIMAEKR PELLVGAGTILTPDALRAAISAGARFGLAPGFDAEIVAAAKAKDFPFAPGIMTPSDLTAV SRNGLKLAKFFPAKAAGGPSMLEAISAPFAHLGTRFVPTGGVSLDNMHEWLKLGAVAAVG GTWIATKADIGEGRWADITAKARAAVARAKQIREVTR