Protein Info for SMc02043 in Sinorhizobium meliloti 1021

Annotation: KHG/KDPG aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF01081: Aldolase" amino acids 10 to 200 (191 residues), 189.2 bits, see alignment E=2.8e-60 TIGR01182: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase" amino acids 10 to 207 (198 residues), 218.8 bits, see alignment E=2.3e-69

Best Hits

Swiss-Prot: 41% identical to ALKD_PSEAE: 2-dehydro-3-deoxy-phosphogluconate aldolase (eda) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 100% identity to sme:SMc02043)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.14, 4.1.3.16

Use Curated BLAST to search for 4.1.2.14 or 4.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MQ7 at UniProt or InterPro

Protein Sequence (217 amino acids)

>SMc02043 KHG/KDPG aldolase (Sinorhizobium meliloti 1021)
MIAPFDQAATLGVVPVIAIERSSDAVALADALLEGGLPLAEITFRTEAAAEVIAIMAEKR
PELLVGAGTILTPDALRAAISAGARFGLAPGFDAEIVAAAKAKDFPFAPGIMTPSDLTAV
SRNGLKLAKFFPAKAAGGPSMLEAISAPFAHLGTRFVPTGGVSLDNMHEWLKLGAVAAVG
GTWIATKADIGEGRWADITAKARAAVARAKQIREVTR