Protein Info for SMc02032 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 PF00005: ABC_tran" amino acids 23 to 173 (151 residues), 96.9 bits, see alignment E=1.7e-31 amino acids 272 to 425 (154 residues), 64.5 bits, see alignment E=1.7e-21

Best Hits

Swiss-Prot: 47% identical to RBSA1_RUBXD: Ribose import ATP-binding protein RbsA 1 (rbsA1) from Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to smk:Sinme_2594)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MR8 at UniProt or InterPro

Protein Sequence (494 amino acids)

>SMc02032 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MDQHEILLKLENIEKRFPGVVALKSISLEVRAGEVQVLLGENGAGKSTLMKILAGEHAPT
GGEIVVGGRKVSALTPTLATELGIGLVHQELSLVPALSVAENILIGRMPRNAFGRINWGK
AYEDARRALEALGVSIDPTAEVRTLEVAEQQLIEITRVLERGPRILLLDEPTSAVSDNER
SRLFDVIRRLKQRGHGIIYISHHLSEIPMIADRVTVLRDGLVVETLPADEADEATVIRLM
VGRRLEEQFPKETVELGAPVLAVENLASGRTLKDLSFTLRRGEILGIYGLMGAGQAEIAN
ALFGLQAVKTGSIEVGGKRADFRHSSDAIAAGLGLISRDRRQSLVPMQPVGPNLSLSWLS
GKSLLSRLDLTREREEGSRYISDLRIRPASTTHKLFFFSGGNQQKVILARWMSSGARILI
FDEPTRGIDVGAKAEVFAVMSRLVSEGASILMISSELNELIGMADRVLVMRSGRLSAELP
REEISQQNLLRYAS