Protein Info for SMc02016 in Sinorhizobium meliloti 1021

Annotation: ferredoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 PF07992: Pyr_redox_2" amino acids 12 to 308 (297 residues), 230.6 bits, see alignment E=1.1e-71 PF00070: Pyr_redox" amino acids 155 to 233 (79 residues), 62.2 bits, see alignment E=2.2e-20 PF13450: NAD_binding_8" amino acids 157 to 191 (35 residues), 23.3 bits, see alignment 2.5e-08 PF14759: Reductase_C" amino acids 327 to 415 (89 residues), 64.8 bits, see alignment E=3.4e-21

Best Hits

Swiss-Prot: 40% identical to CNDC1_SPHSD: Chloroacetanilide N-alkylformylase, ferredoxin reductase component (cndC1) from Sphingomonas wittichii (strain DC-6 / KACC 16600)

KEGG orthology group: None (inferred from 100% identity to sme:SMc02016)

MetaCyc: 38% identical to diphenylamine dioxygenase ferredoxin reductase component (Burkholderia sp. JS667)
RXN-11506

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MT2 at UniProt or InterPro

Protein Sequence (420 amino acids)

>SMc02016 ferredoxin reductase (Sinorhizobium meliloti 1021)
MRPRRGPVHQENMVIVGCGHAGARAAQALRTNGWHGGITLVDGEGRTPYERPPLSKAVLK
GESEAEDAPLFPADFLAKNDIHVLKGVAAAAIDRPTRQLRLSDGGSIAYHRLLLATGAEP
RNLIVPGADLPGSHTLRSADDAARIFPYLRPGAEIVIVGGGLIGLEAAASATVRGCKVTV
VEAGPRPMMRAVPAELSHEVRLFHESKDVRFVLGRQVSELEGDGRVRCVRLDDGTVLPCT
AVVISVGVSPRTALAEAAGLEIDNGIAVDRFLRTSDPFIYAAGDACAFEQVSGPRMRLEC
WKNAEDQGTLAGRNMLGSDEAYVPLPWMWSDQFDRTMQIAGQAGGSAEDVRRRCPDSTLL
IYHLDKDQMILGISGFGSIREVSRGVRMGQLLMERGIRPGRKALADPEFDLRSLAKAAVA