Protein Info for SMc01984 in Sinorhizobium meliloti 1021

Annotation: cytochrome-C oxidase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 47 to 71 (25 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details PF00510: COX3" amino acids 87 to 220 (134 residues), 58.4 bits, see alignment E=5.1e-20

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to smk:Sinme_2567)

Predicted SEED Role

"Alternative cytochrome c oxidase polypeptide CoxO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MU1 at UniProt or InterPro

Protein Sequence (232 amino acids)

>SMc01984 cytochrome-C oxidase transmembrane protein (Sinorhizobium meliloti 1021)
MSIVAFFLAAIAAIIAWWLAGQRLTSRPWLEVGHFHDRRGATRLPPAKIGLGVFLAVVGA
LFSLAISAYFMRMASSDWGALPLPGLLWLNTGILAAGSITLHWTKVEAERRNDEAARIGL
LAGLALGLAFLAGQLFAWRALSDAGYFLAGNPANSFFYLLTGMHGLHIIGGLFALGRVTA
HASQTPLGNRTRLSIELCAIYWHFMLIVWLVLFALFAGWASGVIEFCRQLLT