Protein Info for SMc01983 in Sinorhizobium meliloti 1021

Annotation: alternative cytochrome C oxidase polypeptide I transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 85 to 111 (27 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 174 to 198 (25 residues), see Phobius details amino acids 217 to 243 (27 residues), see Phobius details amino acids 277 to 301 (25 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 377 to 400 (24 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details amino acids 455 to 477 (23 residues), see Phobius details amino acids 497 to 520 (24 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 33 to 558 (526 residues), 679 bits, see alignment E=2.1e-208 PF00115: COX1" amino acids 42 to 506 (465 residues), 460 bits, see alignment E=4.3e-142

Best Hits

Swiss-Prot: 84% identical to COXN_BRADU: Alternative cytochrome c oxidase subunit 1 (coxN) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 100% identity to smk:Sinme_2566)

Predicted SEED Role

"Alternative cytochrome c oxidase polypeptide CoxN (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MU2 at UniProt or InterPro

Protein Sequence (593 amino acids)

>SMc01983 alternative cytochrome C oxidase polypeptide I transmembrane protein (Sinorhizobium meliloti 1021)
MMVDVRSGIGEALPPPEVEDVELYHPHSWWTRYVFSQDAKIIAIQYSMTAIAIGMVALVL
SWLIRLQLGFPGTFELIDAERYYQFITMHGMIMVIYLLTALFLGGFGNYLIPLMVGARDM
VFPYANMLSYWIYLLAVIVLAASFFTPGGPTGAGWTLYPPQAVLSGTPGGRDWGIIMMLS
SLIIFVIGFTMGGLNYVVTVLQGRARGMTLMRLPLTVWGIFTATVMALLAFPALFVACVM
MLFDRLLGTSFFMPAIVEMGEQLQYGGGSPILFQHLFWFFGHPEVYIVALPAFGIVSDLI
STHARKNIFGYRMMVWAIVIIGGLSFIVWAHHMYVSGMNPYFGFFFATTTLIIAVPTAIK
VYNWVLTLWRGNIHLTLPMLFALAFIVTFVNGGLTGLFLGNVVVDVPLSDTMFVVAHFHM
VMGVAPIMVIFGAIYHWYPKITGRMLNEAMGQIHFWVTFIGAYAIFFPMHYLGLIGVPRR
YHELGEASFVTTSIAELNAFISVMALLVGAAQIVFLFNLAWSLRHGREAGGNPWRATTLE
WQTPETPPPHGNWGNELPVVYRWAYDYSVPGAPEDFIPQNQPTPGRLSHETVS