Protein Info for SMc01982 in Sinorhizobium meliloti 1021

Annotation: alternative cytochrome C oxidase polypeptide II transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details PF00116: COX2" amino acids 117 to 237 (121 residues), 61.3 bits, see alignment E=4.3e-21

Best Hits

Swiss-Prot: 72% identical to COXM_BRADU: Alternative cytochrome c oxidase subunit 2 (coxM) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 100% identity to sme:SMc01982)

Predicted SEED Role

"Alternative cytochrome c oxidase polypeptide CoxM (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MU3 at UniProt or InterPro

Protein Sequence (314 amino acids)

>SMc01982 alternative cytochrome C oxidase polypeptide II transmembrane protein (Sinorhizobium meliloti 1021)
MAVVVILVLLAVGSVLFHLLSPWWWTPIASNWNYIDNTITITFWITGIAFTAVVLFMAYC
VLRFRHRPGNTAAYEPENRRLEGWLATGTTFGVAAMLAPGLFVWNQFVTVPQDASEVEVI
GQQWLWSFRLPGADGKLGTTETRDIAPENTLGVNRDDAAGQDDIIIEGGELHLPVGKPVK
MLLRSVDVLHDFYVPEFRAKMDMVPGMITYFWLTPTRTGTFEILCAELCGVGHPQMRGTV
VVDTEEDYQAWLAEQQTFSQLSASSETRAVPEKVCSGFPSGIATEQGTGASALFKEEREC
FGPAATTVAASAAQ