Protein Info for SMc01978 in Sinorhizobium meliloti 1021

Annotation: sugar transport system permease ABC transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 28 to 54 (27 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 280 to 303 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 306 (205 residues), 68.4 bits, see alignment E=3.5e-23

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to sme:SMc01978)

Predicted SEED Role

"ABC-type sugar transport systems, permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MU7 at UniProt or InterPro

Protein Sequence (311 amino acids)

>SMc01978 sugar transport system permease ABC transporter protein (Sinorhizobium meliloti 1021)
MAYAARHDGLPATRPPLMKRIADASAPYLYTAPALILIVTVMLVPLVLGISYAFRDIQLL
NPFSGGFVGLDHFRALAQDQAFFRSLRNTLWWTGASVFLQFAFGLILALLLDKPFHGRAI
AQALVFLPWAVPSFLAGLNWAWLFNPVVGPLPHWLFALGIMSQPTNILSDPQLAMWGPIV
ANIWWGIPFFAITLLAALQAIPRDLYEAASIDGAGPLQRFLSITLPFLAPTIAITILLRT
VWISNFADLIIVMTNGGPADRTQIVASYIFTQAFKRLDFGYASAIALVLLALLLAYSLLI
VILRQWLLSKD