Protein Info for SMc01966 in Sinorhizobium meliloti 1021

Annotation: spermidine/putrescine ABC transporter periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF13416: SBP_bac_8" amino acids 55 to 315 (261 residues), 95.5 bits, see alignment E=5e-31 PF13343: SBP_bac_6" amino acids 90 to 317 (228 residues), 62.7 bits, see alignment E=3.9e-21

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 100% identity to sme:SMc01966)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MV9 at UniProt or InterPro

Protein Sequence (359 amino acids)

>SMc01966 spermidine/putrescine ABC transporter periplasmic protein (Sinorhizobium meliloti 1021)
MIINSIKRRTLLGAGLAGASMLAMPAVLRAQDKSLKVGVYGGYFKDSFDKNIFPEFTKAT
GIAIESVAEPTGEAWLVQLEQAARAGQAPADVSMMSQVAMLKGQATDLWTPIDMAKIKNG
SNLLDRFVNKYPDGRIAGIGAVSWYITLVTNTDVYKEAPTSWQAFWDPANADKLGLLALV
SNSFLLEVTAKTFMGGTNALDTEEGILKTFEKLAEVKPNVRLWYRDEAQFEQALKSGEIP
MGQYYHDVTGLAAADGHPVRSTFPKEGGIQDSGCWALSRASQKVEEAHIFIDYMCQPAVQ
ATLSRKVGTSPTVKRESTDLTDKEFAAVSSDIEPIVPRYDLYQTKSDWLNQKWTELIVG