Protein Info for SMc01965 in Sinorhizobium meliloti 1021

Annotation: spermidine/putrescine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 134.1 bits, see alignment E=1e-42 PF08402: TOBE_2" amino acids 271 to 343 (73 residues), 55.9 bits, see alignment E=7.8e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2547)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MW0 at UniProt or InterPro

Protein Sequence (345 amino acids)

>SMc01965 spermidine/putrescine ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MSGLALQNVVKEFGSFRAVNDVDLTVPHGTFVCMLGPSGCGKTTLLRMIAGLDLPTSGSI
GLDGEDITRVPTHKRNLGMVFQSLALFPHLTVGENIAYPLRIRGAPKEDQKKRVDELLSM
IHLSGYADRPVSKLSGGQRQRVAIARALAISPKLFLLDEPLSALDAKLREAMQVELRQLQ
QKLGITTIVVTHDQREAMTMADTVVVMNGGEIRQAASPIEIYRRPADSFVADFIGQTNLI
EAEADTSGRVTVLGQPVPGLQLPPGAAKAMLSIRPEDVHLTAPGAGALSGTVTFVRDLGG
TIETFVDVAGRQIVAVSTPRARPQVTVGQQVGVALTPDVCVVLAR