Protein Info for SMc01964 in Sinorhizobium meliloti 1021

Annotation: spermidine/putrescine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 59 to 90 (32 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 197 to 226 (30 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 133 to 274 (142 residues), 43.1 bits, see alignment E=2e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2546)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MW1 at UniProt or InterPro

Protein Sequence (284 amino acids)

>SMc01964 spermidine/putrescine ABC transporter permease (Sinorhizobium meliloti 1021)
MRREPPRTLGDYLPILFPAGMLTIFFVVPFGTMIAVSFFQRQQGGFYTPAFVYDNYARFL
SAFFGGVLGFSLMLAIAVAACCVVLALPFTYLLTRMARRVQVVWLVALLSVLSLSEVIIG
FAWSTLFSRTAGITNILVALGLMDEAKALTPSFAAVLTGMVYQAFPYTVLVLFPALVRLD
PTLTEAARTLGASPLRAFFTVVVPALRNTITATLIMVFIFALGSYLLPQLLGRPQHWTLS
VLITDQAIYQSNMPFAAAMAVFLVLVTLGLVALTVIAGRKGEAA