Protein Info for SMc01946 in Sinorhizobium meliloti 1021

Annotation: leucine-specific binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 26 to 361 (336 residues), 209.1 bits, see alignment E=2.2e-65 PF13433: Peripla_BP_5" amino acids 27 to 344 (318 residues), 55.4 bits, see alignment E=8.5e-19 PF01094: ANF_receptor" amino acids 46 to 360 (315 residues), 91.1 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 72% identical to LIVB1_BRUSU: Leu/Ile/Val-binding protein homolog 1 (BR1785) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to sme:SMc01946)

MetaCyc: 41% identical to L-leucine/L-phenylalanine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-35-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q926C5 at UniProt or InterPro

Protein Sequence (372 amino acids)

>SMc01946 leucine-specific binding protein (Sinorhizobium meliloti 1021)
MKKSLLSAVALTAMVAFSGTAWADILVGVGGPLTGPNAAFGAQLQKGAEQAAEDINAAGG
INGEQIKVVLGDDVSDPKQGVSVAQKFVADGVKFVVGHFNSGVSIPASEIYAENGILQVT
PASTNPQFTERGLWNTFRTCGRDDQQGAVAGAYIAANFKDAKVAVIHDKTPYGQGLADET
KKSMNEAGVTEALYEGINTGDKDFSALIAKMKQAGVSIVYYGGLHTEAGLIMRQMKDQGL
KATMMSGDGIVSNELASIAGDAVDGTLMTFAPDPRKSPAAKDLVEKFRAAGFEPEAYTLY
AYAALQVIAEGAKAAGNTDPQAVAEAIKAKGPFKTAIGELGFDEKGDITRPDYVMYTWKK
GDDGKFSYFQNE