Protein Info for SMc01930 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03081: methylmalonyl-CoA epimerase
  • amino acids 4 to 133 (130 residues), 171.4 bits, E=6.2e-55
• PF00903: Glyoxalase
  • amino acids 4 to 130 (127 residues), 49.9 bits, E=6.4e-17
• PF13468: Glyoxalase_3
  • amino acids 6 to 100 (95 residues), 36.5 bits, E=8.3e-13
• PF13669: Glyoxalase_4
  • amino acids 6 to 118 (113 residues), 81.5 bits, E=8.4e-27

Best Hits

KEGG orthology group: K05606, methylmalonyl-CoA epimerase [EC: 5.1.99.1] (inferred from 100% identity to sme:SMc01930)

MetaCyc: 76% identical to ethylmalonyl-CoA/methylmalonyl-CoA epimerase (Cereibacter sphaeroides)
Methylmalonyl-CoA epimerase. [EC: 5.1.99.1]; 5.1.99.1 [EC: 5.1.99.1]

Predicted SEED Role

"Methylmalonyl-CoA epimerase (EC 5.1.99.1); Ethylmalonyl-CoA epimerase" (EC 5.1.99.1)

MetaCyc Pathways

• propanoyl CoA degradation I (3/3 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• methylaspartate cycle (12/19 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• ethylmalonyl-CoA pathway (4/11 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (3/14 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 5.1.99.1

Use Curated BLAST to search for 5.1.99.1

Sequence Analysis Tools

See Q92QN6 at UniProt or InterPro

Protein Sequence (134 amino acids)

>SMc01930 hypothetical protein (Sinorhizobium meliloti 1021)
MLGKVNHVAIAVPDLSAAVESYRSTLGASVTEPQALPEHGVTVVFVMLPNTKVELLEPLG
EGSPISAFLEKNPAGGMHHICYEVEDIIAARDRLRQAGARILGDGNPKIGAHGKPVLFLH
PKDFQGTLIELEEV