Protein Info for SMc01927 in Sinorhizobium meliloti 1021

Annotation: NADH dehydrogenase subunit N

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 203 to 227 (25 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 369 to 393 (25 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details amino acids 446 to 465 (20 residues), see Phobius details TIGR01770: proton-translocating NADH-quinone oxidoreductase, chain N" amino acids 12 to 439 (428 residues), 500.1 bits, see alignment E=3.7e-154 PF00361: Proton_antipo_M" amino acids 125 to 419 (295 residues), 304.1 bits, see alignment E=5e-95

Best Hits

Swiss-Prot: 100% identical to NUON1_RHIME: NADH-quinone oxidoreductase subunit N 1 (nuoN1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00343, NADH dehydrogenase I subunit N [EC: 1.6.5.3] (inferred from 100% identity to smk:Sinme_1076)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain N (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QN9 at UniProt or InterPro

Protein Sequence (480 amino acids)

>SMc01927 NADH dehydrogenase subunit N (Sinorhizobium meliloti 1021)
MTAETLIASLQLSMPELILAVGAMALLMIGVFSGERATPTVTGLAVAVLIIAGLWLVLKT
GEGEAYGGAFLSDPFAKFMKVLALIGSITVMVMTVGHARSAQIDRFEFPVLLVLATLGML
LMISANDLISLYLSLELQSLALYVVAAINRDSVRSTEAGLKYFVLGALSSGMMLYGMSLV
YGFTGHTGFDEIAAALTAEGRSLGLVFGLVFILAGLAFKISAVPFHMWTPDVYEGAPTPV
TAFFAAGPKVAAISILVRIVINAFEPVVADWQQIIVFISIASMLLGSFAAIGQRNIKRLM
AYSSIGHMGYALVGLAAGSMAGVRGVILYMLIYMVMTLGTFACILAMRRREGEHVEGIDD
LAGLSQTNPFMATVLTILMFSLAGIPPLAGFFAKYFVFVAAIEAQLYGLAIIGVLASVVG
AYYYLRVIKVMWFEEPRGEFARTAGELRLVFGLSGLFVLGYVLIGGPLGTAAEAAARTFF