Protein Info for SMc01868 in Sinorhizobium meliloti 1021

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase
  • amino acids 34 to 306 (273 residues), 162 bits, E=9.3e-52
• PF01565: FAD_binding_4
  • amino acids 44 to 172 (129 residues), 55.4 bits, E=5.7e-19
• PF02873: MurB_C
  • amino acids 207 to 306 (100 residues), 111.6 bits, E=1.8e-36

Best Hits

Swiss-Prot: 100% identical to MURB_RHIME: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 100% identity to sme:SMc01868)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)
• peptidoglycan recycling I (8/14 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

See Q92NM1 at UniProt or InterPro

Protein Sequence (324 amino acids)

>SMc01868 UDP-N-acetylenolpyruvoylglucosamine reductase (Sinorhizobium meliloti 1021)
MKQVNGQKLLDSLGSGVAAIRGRLTPDAPMDRVTWFRAGGLAELMFQPHDTDDLVAFLKL
VPEEVPVMVVGVGSNLLVRDGGIPGVVIRLSAKGFGDLELAGENRIKAGAICPDKNIAAM
ALDHGIGGFYFYYGIPGSIGGALRMNAGANSGETSERVVEVHAVDRKGNRHVLSKAEMGY
GYRHSGAAKELIFTHAIFEGYAEDKTKIRTDMDAVRQHRETVQPIREKTGGSTFKNPDGH
SAWKLIDEAGCRGMMIGNAQMSPLHCNFMINTGQATGYELEYLGETVRQRVMEHSGVKLE
WEIKRVGNFMPGYEIREFLGRATA