Protein Info for SMc01867 in Sinorhizobium meliloti 1021

Annotation: UDP-N-acetylmuramate--L-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01082: UDP-N-acetylmuramate--L-alanine ligase
  • amino acids 10 to 458 (449 residues), 538.9 bits, E=5.7e-166
• PF01225: Mur_ligase
  • amino acids 10 to 106 (97 residues), 112.8 bits, E=1.2e-36
• PF08245: Mur_ligase_M
  • amino acids 112 to 298 (187 residues), 101.2 bits, E=1.2e-32
• PF02875: Mur_ligase_C
  • amino acids 320 to 450 (131 residues), 69.3 bits, E=9.1e-23

Best Hits

Swiss-Prot: 100% identical to MURC_RHIME: UDP-N-acetylmuramate--L-alanine ligase (murC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to sme:SMc01867)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

See Q92NM0 at UniProt or InterPro

Protein Sequence (471 amino acids)

>SMc01867 UDP-N-acetylmuramate--L-alanine ligase (Sinorhizobium meliloti 1021)
MKMPKTIGLVHFIGIGGIGMSGIAEVLHNLGHRVQGSDQADSANVQRLREKGISISIGHK
AENLGDAEVVVVSTAIKKDNPELIAAREKFLPVVRRAEMLAELMRFRNAIAIGGTHGKTT
TTSMVAALLDAGGLDPTVINGGIINAYGTNARMGAGEWMVVEADESDGTFLKLPADIAVV
TNIDPEHLDHYGSFDAVRAAFRQFVENVPFYGFGVLCLDHPEVQSMVGKIEDRKVVTYGE
NPQADVRFHNIRMDGATSIFDIEIRRRRTGQVIEIKDLRLPMPGRHNVSNATAAVAVAQR
LGIKPEDIARGLATFGGVKRRFTLTGEWNGARIFDDYGHHPVEIRAVLRAAREACQGRIV
AVHQPHRYSRLSSLFEDFTSCFNDADTILLAPVYAAGEEAIEGVSSEALVDRIKAAGHRD
ARHVPGQEALAPVIAKIAQPGDFVVLLGAGSITYWAAALPKQLAEISGNRA