Protein Info for SMc01858 in Sinorhizobium meliloti 1021

Annotation: S-adenosyl-methyltransferase MraW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF01795: Methyltransf_5" amino acids 17 to 312 (296 residues), 319.7 bits, see alignment E=1.2e-99 TIGR00006: 16S rRNA (cytosine(1402)-N(4))-methyltransferase" amino acids 18 to 312 (295 residues), 299.5 bits, see alignment E=1.7e-93

Best Hits

Swiss-Prot: 100% identical to RSMH_RHIME: Ribosomal RNA small subunit methyltransferase H (rsmH) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03438, S-adenosyl-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to sme:SMc01858)

Predicted SEED Role

"rRNA small subunit methyltransferase H" in subsystem Bacterial Cell Division

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NL4 at UniProt or InterPro

Protein Sequence (341 amino acids)

>SMc01858 S-adenosyl-methyltransferase MraW (Sinorhizobium meliloti 1021)
MVTDQGGGTSEADGGPVRHIPVLLKEVLAALDPAPGKIILDGTFGAGGYASAILDAGADV
VALDRDPTAIAAGQSMMHASGGRLKLVHSRFSDLAEHAPAQGLDGVVLDIGVSSMQIDEA
ERGFSFQKKGPLDMRMSAAGVSAADVVNRAKVSDLIRIFGFLGEEKQAGRIARAIEKRRA
ETPFETTRDLANLIETVTPRKAKDKIHPATRVFQALRIFVNDELGELAHALFAAERALKP
GGRLVVVTFHSLEDRIVKTFFQDRSGKAGGSRHLPLVTARAATFTPVGKPMVAASEEEAS
RNPRARSAKLRAGVRTEAPSPGADLSIFNLPELASLARLGG