Protein Info for SMc01846 in Sinorhizobium meliloti 1021

Annotation: hydrolase glycosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01183: Glyco_hydro_25" amino acids 56 to 234 (179 residues), 207.7 bits, see alignment E=9.2e-66

Best Hits

KEGG orthology group: K07273, lysozyme (inferred from 100% identity to sme:SMc01846)

Predicted SEED Role

"Lyzozyme M1 (1,4-beta-N-acetylmuramidase) (EC 3.2.1.17)" (EC 3.2.1.17)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NK4 at UniProt or InterPro

Protein Sequence (261 amino acids)

>SMc01846 hydrolase glycosidase (Sinorhizobium meliloti 1021)
MRRLLLALLPIATILSSCTSTDYDLVKTASIQPRFHDTDPQDFGGRTPHHHSVHGIDVSK
WNGDIDWRKVKNSGVSFAFIKATEGKDRVDSRFHEYWQQARAVGLAYAPYHFYYFCSTAD
AQADWFIANVPKSAVHLPPVLDVEWNGESKTCRHRPAPETVRSEMKRFMDRLEAHYGKRP
IIYTSVDFHHDNLVGAFNDYHFWVRSVAKHPKDIYVERRWAFWQYTSTGVIPGIQGSTDI
NAFAGSARNWQKWVATVSQAR