Protein Info for SMc01845 in Sinorhizobium meliloti 1021

Annotation: transglycosylase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02283: lytic murein transglycosylase" amino acids 43 to 335 (293 residues), 355.9 bits, see alignment E=8.5e-111 PF13406: SLT_2" amino acids 44 to 330 (287 residues), 301.7 bits, see alignment E=5.3e-94 PF01471: PG_binding_1" amino acids 351 to 405 (55 residues), 47.3 bits, see alignment 1.9e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2177)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NK3 at UniProt or InterPro

Protein Sequence (405 amino acids)

>SMc01845 transglycosylase transmembrane protein (Sinorhizobium meliloti 1021)
MTATARKALLSLGFLAIAGAPALAQAPAQPGNPAAACGGDLGSFLEGVKAEAVAKGIPAD
VADRALAGAAIDQKVLSRDRAQGVFKQTFTEFSKRTVSKSRLDIGAQKMREYADVFARAE
QEFGVPAPVITAFWAMETDFGAVQGDFNTRDALVTLAHDCRRPEMFRPQLLAAIEMVQHG
DLDPAATTGAWAGEIGQVQMLPEDIIAYGVDGDGDGHVNLKKSSPDAILTAAKFIQSLGF
KPGEPWIQEVRVPEQLPWEKTGLQPGMTAGDWFALGVAPRDGNTSNSGLEASLVLPQGRK
GAAFLTYPNFKIYLEWNQSFIYTTSAAYFATRLAGAPPYQQGNPEPGLGDAEMKALQTRL
QALGHDVGKIDGILGSGTRAALQKEQLKLGIPADGWATPGLLEAL