Protein Info for SMc01842 in Sinorhizobium meliloti 1021

Annotation: methyltransferase transcription regulator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF12840: HTH_20" amino acids 21 to 64 (44 residues), 30.5 bits, see alignment 1.4e-10 PF01022: HTH_5" amino acids 22 to 61 (40 residues), 44.2 bits, see alignment 6.9e-15 PF13489: Methyltransf_23" amino acids 143 to 295 (153 residues), 52.3 bits, see alignment E=2.9e-17 PF01209: Ubie_methyltran" amino acids 149 to 268 (120 residues), 44.3 bits, see alignment E=7.3e-15 PF07021: MetW" amino acids 157 to 300 (144 residues), 21.2 bits, see alignment E=1e-07 PF13847: Methyltransf_31" amino acids 159 to 272 (114 residues), 75.1 bits, see alignment E=2.6e-24 PF08241: Methyltransf_11" amino acids 161 to 257 (97 residues), 83.3 bits, see alignment E=7.8e-27 PF08242: Methyltransf_12" amino acids 161 to 255 (95 residues), 55 bits, see alignment E=5.9e-18 PF13649: Methyltransf_25" amino acids 161 to 253 (93 residues), 73 bits, see alignment E=1.4e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2180)

Predicted SEED Role

"Transcriptional regulator, ArsR family / Methyltransferase fusion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NK0 at UniProt or InterPro

Protein Sequence (340 amino acids)

>SMc01842 methyltransferase transcription regulator protein (Sinorhizobium meliloti 1021)
MADRETLGLDALVDVLKAAGEPTRLRLLALLSAGDLTVTDLTEILGQSQPRISRHLKLLA
EVALTDRYQEGAWAYFRLRQEGRRVALIRELLASAAADDAILARDAIRLATLKRTRAEKA
QAYFSRNAAEWDKLRRLHIAEGDVEAALKAMVGDEPVDSLLDLGTGTGRILQLFEGIYRR
GIGVDASRDMLAVARSNLDRAGITKASIRHGDIFNLPLDGQSFDLVTIHQVLHYLEEPEA
AIAEAARMLVPGGRLVIIDFAPHGLEHLRDDHAHARLGFSHQTMSEWLQKADLSLEKTTD
LAPEGGQEGKLTVTIWLARDQRAAETVADLPRQRLHAGGV