Protein Info for SMc01826 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 36 to 53 (18 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 277 (173 residues), 93.1 bits, see alignment E=9.2e-31

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to sme:SMc01826)

Predicted SEED Role

"Pyrimidine ABC transporter, transmembrane component 2" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MY8 at UniProt or InterPro

Protein Sequence (289 amino acids)

>SMc01826 ABC transporter permease (Sinorhizobium meliloti 1021)
MNLAALAGAILFWLAAWAFNEWLVRKQFASDAANNAARVAVPLLFGITILVLWEGIVRGF
AVPSVLLPAPSMIWQRLINSLPTLAADFRQTFLKSVLTGYALGCGLGFVVAILIDRSPFL
QKGLLPLGNFVSALPVIGVAPIMVMWFGFDWQSKVAVVVIMTFFPMLVNTVSGLAAASHM
ERDLMRTYAASWWQTLVKLRLPAAWPFIFNALKINSTLALIGAIVAEFFGTPIVGMGFRI
STEVGRMNVDMVWAEIAVAAVAGSVFYGMVALIERAVTFWHPSIRSGRT