Protein Info for SMc01825 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 94 to 120 (27 residues), see Phobius details amino acids 132 to 156 (25 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 261 to 285 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 108 to 290 (183 residues), 90.2 bits, see alignment E=7.2e-30

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to smk:Sinme_2506)

Predicted SEED Role

"Pyrimidine ABC transporter, transmembrane component 1" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MY9 at UniProt or InterPro

Protein Sequence (294 amino acids)

>SMc01825 ABC transporter permease (Sinorhizobium meliloti 1021)
MREESLLKDKLLPVSTVVLLLIAGWYVASVFLNAPFERDTAARAGTEIGFSEILRNTMAQ
ERPVLPAPHQLIAEIWDTTANKAITSKRSLVYHAWITLSATLLGFGIGTVLGVLLAVGIV
HNRAMDRSLMPWVIASQTIPILAIAPMIIVVLNAIGISGLLPKALISTYLSFFPVVVGMV
KGLRSPETIQLDLMHTYNASPAQTFWKLRWPSSMPYLFTSLKVAVAISLVGAIVGELPTG
AVAGLGARLLAGSYYGQTVQIWAALFMAAALAAVLVMIVGLAHTAVLKRMGAKP