Protein Info for SMc01807 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details amino acids 23 to 23 (1 residues), see Phobius details transmembrane" amino acids 19 to 22 (4 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details PF00892: EamA" amino acids 141 to 275 (135 residues), 46.8 bits, see alignment E=1.7e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc01807)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QR1 at UniProt or InterPro

Protein Sequence (278 amino acids)

>SMc01807 hypothetical protein (Sinorhizobium meliloti 1021)
MPPDVIALVLLGALLHATWNALVKAGTEKSLDAAMVSLGGAVVALPFLPFLPMPGSEAVP
YILVSALFQFAYFQLVAAAYRAGDIGLVYPLMRGVAPLIVAATSSLVIGEKLTGGAMAGI
MTISAGVLTLAFESRKGGRHAIVLALLNACVIASYTYVDGIGARISGNAISYTLWMALLP
PVLLFGWAFARRGVKPVARHVSRHWWRGLIGGAGSIGSYGLALWAMTKAPVATVAALRET
AILFAVVISVVFLKERVSAWRIIAAFIIALGALLLRLA