Protein Info for SMc01795 in Sinorhizobium meliloti 1021

Annotation: polysaccharide transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 712 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 434 to 456 (23 residues), see Phobius details PF02706: Wzz" amino acids 11 to 104 (94 residues), 38.5 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc01795)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QS3 at UniProt or InterPro

Protein Sequence (712 amino acids)

>SMc01795 polysaccharide transporter (Sinorhizobium meliloti 1021)
MSGIGGQQDVDIDLGGLFRAIWQRRVRVLLATVGAGAVAFGAAKMVAPDYEGETRVLIES
REPEFSGANQVSQNGSDRMFDESGILSQVQVLRSADLIKQVARNMKLHELDEFDPSARPS
AASDLLVMLGLKKNPLDLPPEERVLKEFEEKLQVYQVEKSRVIAIAFTSKDATLAAAIPN
EMANVYLSLQSGAKLDSNSEASRWLEPEIANLREKVREAEAKVALYRAESGLLPAGETQN
FATRQLTDISTELARVRSERANTAARAEGMRTALADGRPADTLADIVGSPMIQRLKENHA
NVQAQIADLSTALLDGHPRLKGLKSQLEGIEGAIRSETRKILASLENEAKVGQLREQQLV
QQMNTLKAQSAQAGEEEVGLRALEREATAQRQLLETYLARYREATSRTVANATPADARVI
SRAVVPTSQSFPKVLPITIVAAFASLLFSCVVIMLGELFSGRALRPVSVPEAPAPGQPAE
MPSVPGAVEENPASVLAAADPAPEENGDDGNAASKHDFSIESVAEHLRANGVRIAVSVSP
GGDEGSTATVMLARLLAEDGQKVVLIDLSGSACPTRLMAQSRDLAGVTNLLMGEVAFSGS
IHSDRLSEAHIIPHGDADPHAAMRGIDRLQIIIDALANAYDLVLIECGSADAEAVAKVAR
HEGTEIILSAPSISDDEIVEMLMSFGEAGYRDVVLMTGKGQDGPDFPDRRAA