Protein Info for SMc01724 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00357: methionine-R-sulfoxide reductase
  • amino acids 39 to 162 (124 residues), 150.1 bits, E=1.8e-48
• PF01641: SelR
  • amino acids 43 to 161 (119 residues), 160.4 bits, E=8.6e-52

Best Hits

Swiss-Prot: 44% identical to MSRB_METTH: Peptide methionine sulfoxide reductase MsrB (msrB) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 100% identity to smk:Sinme_0073)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.12

Use Curated BLAST to search for 1.8.4.12

Sequence Analysis Tools

See Q92SF8 at UniProt or InterPro

Protein Sequence (164 amino acids)

>SMc01724 hypothetical protein (Sinorhizobium meliloti 1021)
MISRRDLLMAGAALAAVVALRGLVWPVRAVAGEAFEITRTDAEWRALLGEDRYRVLREEG
TEPPFSSALDNEKRNGVFHCAGCELPVYSSDAKYDSGTGWPSFWQALPGAIGTREDDTLF
VTRTECHCRRCGGHLGHIFDDGPPPTGKRHCINGLALSFVPETA