Protein Info for SMc01698 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00106: adh_short" amino acids 8 to 196 (189 residues), 184.5 bits, see alignment E=3.2e-58 PF01370: Epimerase" amino acids 11 to 188 (178 residues), 27.4 bits, see alignment E=4.4e-10 PF08659: KR" amino acids 11 to 162 (152 residues), 34.5 bits, see alignment E=4e-12 PF13561: adh_short_C2" amino acids 14 to 248 (235 residues), 216.6 bits, see alignment E=7.9e-68

Best Hits

Swiss-Prot: 40% identical to YXBG_BACSU: Uncharacterized oxidoreductase YxbG (yxbG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_1492)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PX8 at UniProt or InterPro

Protein Sequence (251 amino acids)

>SMc01698 oxidoreductase (Sinorhizobium meliloti 1021)
MKLGLEGKIAIVTGAGSGIGAAVSRQLGGEGAEVIVADRDADAARSVAAEIRSAGGRARD
FTVDVTDAGAVEQMVAFTVRECGGLHLAVNNAGIEGPRQATADYPLEDWRRLIEVNLNGV
FYCMKYEIAAMLGKGGGAIVNMSSILGAVALPTASAYTAAKHGVVGLTKAAGIEYARMGI
RINAVGPGWIETPLLSGHSELAKTRRLEALQPLGRRGKPEEVAALVCFLLSEQASFITGS
YHPVDGAFTAH