Protein Info for SMc01644 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 73 to 97 (25 residues), see Phobius details amino acids 116 to 142 (27 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 233 to 258 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 264 (178 residues), 100.4 bits, see alignment E=5.3e-33

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to smk:Sinme_2236)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NE9 at UniProt or InterPro

Protein Sequence (275 amino acids)

>SMc01644 ABC transporter permease (Sinorhizobium meliloti 1021)
MNLRSIPFSAWIGIIGIAVALLCALFAPVLAPFGEREVVGEIWLPAGGDFLLGTDNLGRD
LLSRLIYGARTTIFVALAATVLSFALGMILSFTAAVTGGFVDQFFSRFNDLMMAVPTLIF
ALVVLAVLPQHLWILVLVMAVLDSTRVFRIGRAVALDVAVMEFVEAARLRGEGNVWIIFR
EILPNTLSPLLAEFGLRFAFSILFLSTLSFLGLGIQPPAADWGGMVKDNKDGIIFGISAA
LIPGAAIAALAICVNLVVDWLMKRTSSLKGGRGDA