Protein Info for SMc01641 in Sinorhizobium meliloti 1021

Annotation: carnitinyl-CoA dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 12 to 262 (251 residues), 199.5 bits, E=6.3e-63
• PF16113: ECH_2
  • amino acids 19 to 243 (225 residues), 92.8 bits, E=3.1e-30

Best Hits

Swiss-Prot: 58% identical to CAID_SALAR: Carnitinyl-CoA dehydratase (caiD) from Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

KEGG orthology group: K08299, carnitinyl-CoA dehydratase [EC: 4.2.1.-] (inferred from 100% identity to sme:SMc01641)

Predicted SEED Role

"Enoyl-CoA hydratase [branched-chain amino acid degradation] (EC 4.2.1.17)" (EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (29/35 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (12/14 steps found)
• adipate degradation (5/5 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• adipate biosynthesis (4/5 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• phenylacetate degradation I (aerobic) (5/9 steps found)
• valproate β-oxidation (5/9 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• superpathway of phenylethylamine degradation (6/11 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of plant hormones
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid biosynthesis
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Propanoate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 4.2.1.17

Use Curated BLAST to search for 4.2.1.- or 4.2.1.17

Sequence Analysis Tools

See Q92NF2 at UniProt or InterPro

Protein Sequence (263 amino acids)

>SMc01641 carnitinyl-CoA dehydratase (Sinorhizobium meliloti 1021)
MTPMTGPILTRREGGILEVTIDRPKANAIDLKTSRVMGEIFRDFRDDPELRVAIITGAGE
KFFCPGWDLKAAAEGDPVDGDYGVGGFGGMQELRDLNKPIIAAVNGICCGGGLEIALSTD
IILAAEHASFALPEIRSGTLADAASIKLPKRIPYHIAMDMLLTGRWLDVVEANRWGFVNE
ILPAGRLMDRAWELARLLESGPPLVYAAIKEVVRDAEGRDFQTTMNKVTRRQFRTVDVLY
SSEDQLEGARAFAEKRDPVWKGR