Protein Info for SMc01634 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 54 to 77 (24 residues), see Phobius details amino acids 89 to 118 (30 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 70 to 263 (194 residues), 46.5 bits, see alignment E=1.8e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2226)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NF9 at UniProt or InterPro

Protein Sequence (272 amino acids)

>SMc01634 ABC transporter permease (Sinorhizobium meliloti 1021)
MRAFISSVYLFLYAPIALVVLFSFNAGRNASEFTGFSLAWYGKALGNTFLVSALQNSLII
AFTSATLAAVFGTMAALGMERLGSRMRALFDALFAAAIVVPGVVIGIATLVALVAVFSFV
NPTIAALWPGEQPPQLGLGYGSIIAAHGLFSMALVTMIVKARIASLGRDIVEASGDLYAT
PLTTFRLIVLPQILPSILAGFLLAFTFSFDDFIIAFFVAGSKTTLPIYVFASIRRGVTPE
INAIATLVLVASLLLILTARVLMREKKSKSGE