Protein Info for SMc01631 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF00005: ABC_tran" amino acids 25 to 169 (145 residues), 134.7 bits, see alignment E=3.5e-43 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 39 to 356 (318 residues), 364.9 bits, see alignment E=1.8e-113 PF08402: TOBE_2" amino acids 281 to 357 (77 residues), 67.1 bits, see alignment E=1.3e-22

Best Hits

Swiss-Prot: 52% identical to POTA_ROSDO: Spermidine/putrescine import ATP-binding protein PotA (potA) from Roseobacter denitrificans (strain ATCC 33942 / OCh 114)

KEGG orthology group: K11072, spermidine/putrescine transport system ATP-binding protein [EC: 3.6.3.31] (inferred from 100% identity to smk:Sinme_2223)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.31

Use Curated BLAST to search for 3.6.3.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NG2 at UniProt or InterPro

Protein Sequence (359 amino acids)

>SMc01631 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MTSASTNDIEFRSVAKRYGSVTAVSDINLTVPKGAFVALLGPSGCGKTTCLRMIGGFEQP
SEGMVYIGGQPMNGVPAYRRPVNMVFQQYALFPHLDVEQNVAYGLKQTRPRIPAAEITRR
AQEALEMVRLGGFGKRRIHEMSGGQQQRVALARAIVNKPKVLLLDEPLAALDKKLRTAMQ
IELQSLQRELGITFVLVTHDQEEALSMSDFVCVMSTGRIVQIGPPQEIYDRPASLFVADF
VGKTNRIAGTIEPGAGAVLLANGVGLAKPARANGTAGPVMVALRPEAISLVRDGSAALRG
TVTHRIFLGSSVEYSVEVEGLGDFLVTADRRSLNDSDLAEPGERIGLSFDPNAMHVFPA