Protein Info for SMc01629 in Sinorhizobium meliloti 1021

Annotation: ERY operon repressor transcription regulator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF04198: Sugar-bind" amino acids 66 to 317 (252 residues), 248.2 bits, see alignment E=3.8e-78

Best Hits

Swiss-Prot: 61% identical to ERYD_BRUA2: Erythritol catabolism regulatory protein EryD (eryD) from Brucella abortus (strain 2308)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2221)

Predicted SEED Role

"Erythritol transcriptional regulator EryD" in subsystem Erythritol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NG4 at UniProt or InterPro

Protein Sequence (319 amino acids)

>SMc01629 ERY operon repressor transcription regulator protein (Sinorhizobium meliloti 1021)
MAIIGGMAVRDDEASMATRAAWLHYAGGLTQAEVAKRLGLTSLKAHRLIMKANQEGLVKV
YIDGDVSECVELEQKLSSRYGLDYCEVVPDFDSDDLPLKALGISGAQFLRREIERGETAL
IGVGHGRTLAASIEYMPRTASNNTRFVSLLGGLTRKFSANPHDVIHRLAERTGAEAYVMP
VPFFANTVEDRDVLFSQRGVREVFDLAKSADLLMVGIGTAEREASLVATGMIEMREIAEI
QKAGGVGELLGHFFDEKGRPIETALSNRTFTLGRQDLKNRRTVAIAGGRVKTRPIRAVLE
SGFLSGLITDERTAQTLAA