Protein Info for SMc01627 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 166 to 190 (25 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 96 to 288 (193 residues), 51.6 bits, see alignment E=4.9e-18

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_2219)

Predicted SEED Role

"Predicted erythritol ABC transporter 1, permease component 1" in subsystem Erythritol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NG6 at UniProt or InterPro

Protein Sequence (307 amino acids)

>SMc01627 ABC transporter permease (Sinorhizobium meliloti 1021)
MASVTHSSPRGSRFRISKRALPYVLSLPALLVCIGILIPFFTAVIYSFQRYRLSQPWARQ
FNWGENYLNFFTDPGFWNTLKISLLYAGVTVTLELLLGLGIALLLQRRSTVNNFISIMLL
LPLMTAPALAALMWKLMTNPGFGILSYLASLVGLENFRWASSPDTALLTVVLVDIWVYTP
FIMILLLAGLRSLPTQPFEAAALDGVPRSFVFFRITLPMLTPYILTATLFRLLDSIQQFD
IIYAMTQGGPGDTLTVFQVEAYLNFFQSTNVGRSAALLIILWAITYALSNIFIKNWLRLR
ERARGEA