Protein Info for SMc01624 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF00005: ABC_tran" amino acids 26 to 167 (142 residues), 104.1 bits, see alignment E=1.5e-33 PF17912: OB_MalK" amino acids 241 to 296 (56 residues), 29.7 bits, see alignment 1.5e-10 PF08402: TOBE_2" amino acids 292 to 359 (68 residues), 37.3 bits, see alignment E=3.6e-13

Best Hits

Swiss-Prot: 36% identical to UGPC_BORBR: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to sme:SMc01624)

Predicted SEED Role

"Predicted erythritol ABC transporter 1, ATP-binding component 2" in subsystem Erythritol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NG9 at UniProt or InterPro

Protein Sequence (374 amino acids)

>SMc01624 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MNATALLIDNVDKFYGPVDYGVHAVKQLKMEVKKGEIIALLGSSGCGKTSTLRMIAGFEP
VSRGTISVAGRQVHMLAPVRRNVAMAFEGYSLYPPLTVRENIAFALKASKLSQSVVEEKV
ASIAKLLEIEDILGRYPSSISGGQQQRASLGRALIRDADLHLLDEPMGQLEPQLRAVLRG
RIKHYIKERGLTAILVTHDQTEANALADRIAVMEGGVLQQFDTPQKIKERPANLFTGTFV
GEPPMNVFEASISGTDARVTFGLKDGVRLEYQAADFSHAVRDALMKRQNVVLGIRPYSVR
RSADGVTGRVAVNQWLGDQTHIAADFAGGTMVLVEHDRTSLEIGQPIGIRLDPASLHVFD
SESGMAISHGEELA