Protein Info for SMc01616 in Sinorhizobium meliloti 1021

Annotation: D-erythrulose-1-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF01261: AP_endonuc_2" amino acids 51 to 296 (246 residues), 50.3 bits, see alignment E=1.4e-17

Best Hits

Swiss-Prot: 69% identical to ERYC_BRUA2: D-erythrulose 1-phosphate 3-epimerase (eryC) from Brucella abortus (strain 2308)

KEGG orthology group: None (inferred from 100% identity to sme:SMc01616)

MetaCyc: 69% identical to D-erythrulose 1-phosphate 3-epimerase (Brucella abortus)
RXN-17771 [EC: 5.1.3.38]

Predicted SEED Role

"Possible D-erythrulose 4-phosphate dehydrogenase EryC (EC 1.1.1.-)" in subsystem Erythritol utilization (EC 1.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.- or 5.1.3.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NH6 at UniProt or InterPro

Protein Sequence (312 amino acids)

>SMc01616 D-erythrulose-1-phosphate dehydrogenase (Sinorhizobium meliloti 1021)
MAFTLSLNTNPLVNRFAEADDLIDTIAEKIRIGHVQLTHEFVNPGWPAATINKTLRQFRT
ALGRTGVKITSGMTGPYGRLNHFGHPDADVRRYYVDWFKTFADISAELGASGMGTQFAIF
TLRDYHDPARREELMTIAIECWREVAEHAKAAGLSYVFWEPMSVGREFGHTIEECRALDR
RLAAADLPIPMRMMVDIDHGDVTSPNAADVDPYAWAEAFPRQSPIIHVKQSSMNKGGHWP
FTAVYNKDGRITPERLLDAVRRGGGTDNEICLELSFREREPTDRNVVEMIRESVEFWEPF
IDTGFNASKYHM