Protein Info for SMc01606 in Sinorhizobium meliloti 1021

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 43 to 70 (28 residues), see Phobius details amino acids 82 to 106 (25 residues), see Phobius details amino acids 129 to 156 (28 residues), see Phobius details amino acids 180 to 225 (46 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 67 to 260 (194 residues), 35.6 bits, see alignment E=4e-13

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to sme:SMc01606)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NI4 at UniProt or InterPro

Protein Sequence (268 amino acids)

>SMc01606 permease (Sinorhizobium meliloti 1021)
MIFALMFLVVPTLYLVTGAFLTPAGEFTFKNIADLFTPSILSAYWISIRVSVASSLGGAL
IGFFLAWAIVLGGMPKWIRSGLLTFSGVASNFAGVPLAFAFLATLGRTGLVTVFLRDWFG
FNLYSTGFNLLSFLGLTITYMYFQIPLMVLILTPALDGMKKEWREASEILGASTWQYWRM
VALPILWPSLLGTTLLLFANAFGAIATAYALTGSSLNIVPILLYAQIRGDVLHNPNLGYA
LALGMIVITGISNILYIWLRMRAERWQK