Protein Info for SMc01595 in Sinorhizobium meliloti 1021

Annotation: sensor histidine kinase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 34 to 58 (25 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details PF02518: HATPase_c" amino acids 356 to 459 (104 residues), 79.3 bits, see alignment E=1.5e-26

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 100% identity to smk:Sinme_2383)

Predicted SEED Role

"Osmolarity sensor protein EnvZ (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N80 at UniProt or InterPro

Protein Sequence (460 amino acids)

>SMc01595 sensor histidine kinase transmembrane protein (Sinorhizobium meliloti 1021)
MASFDGLKREGTTPADGGWKRVVRWLRRRLPMGLYARSILIVVIPMVLLQSVVAFVFMER
HWQLVTQRLSSAVTNDIAAIVDLITTFPREGDIDQIVRIARDQLDLNITVEPGGELPPPR
PKPFFEILDQILSEEISDQIRRPFWIDTVGNSKIVEIRIKLEDDRILRVYARRNQAYASN
THIFLVWMVGASLVLLTIAILFLRGQIRPILALASAAESFGKGQKIDDFAPRGANEIRRA
GLAFILMRERIERQIEQRTAMLTGVSHDLRTILTRFKLQLALVGNNPDLESLNQDVEDMQ
NMLEGYLAFARGDAEEDVGRLKLSDLMARLAAEAELYGKTLTTAIQGENEIHVRPNAFTR
LVSNLASNAYRYANTVHIEARQSAKWLTITVDDDGPGIPERSREDVFKPFFRLDEARNLD
SSGTGLGLAVARDIARSHGGNVTLADSPLGGLRATVRVPT