Protein Info for SMc01584 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 139 (133 residues), 64.1 bits, see alignment E=8.5e-22 amino acids 149 to 281 (133 residues), 57.1 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc01584)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N87 at UniProt or InterPro

Protein Sequence (300 amino acids)

>SMc01584 hypothetical protein (Sinorhizobium meliloti 1021)
MTRIQANLFLLFSGAIWGAGFVAQSTAMDAIGPLWFIGLRFAIATLVALPLALLEKKQAA
TPLPRNAMRNFVFVGLALFGGAVTQQYGLLTTTVTNSGFLTGLYVVFVPVLTVVFLRRRP
HWVIWPAALLAAFGIFLLSGGALSALTGGDMLTIVCALFWAVQLMLVGLFAPATGRPMLL
SMTQFAVCAVAGCVLAGLFEPLSLDAINGALPQILYAGIFSSGIAFICQVVGQRYTTAPQ
AAIFLSSEALFAALFGVLLLGETITPVGYVGCAVIFLAMLAVELVPELTKKRREAAQAAV