Protein Info for SMc01531 in Sinorhizobium meliloti 1021

Annotation: 2-dehydro-3-deoxygluconokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00874, 2-dehydro-3-deoxygluconokinase [EC: 2.7.1.45] (inferred from 100% identity to smk:Sinme_2455)

Predicted SEED Role

"2-dehydro-3-deoxygluconate kinase (EC 2.7.1.45)" in subsystem D-Galacturonate and D-Glucuronate Utilization or D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.45)

MetaCyc Pathways

4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
D-fructuronate degradation (4/4 steps found)
superpathway of β-D-glucuronosides degradation (6/7 steps found)
superpathway of hexuronide and hexuronate degradation (8/10 steps found)
Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
D-galacturonate degradation I (4/5 steps found)
3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
alginate degradation (2/7 steps found)
superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N31 at UniProt or InterPro

Protein Sequence (305 amino acids)

>SMc01531 2-dehydro-3-deoxygluconokinase (Sinorhizobium meliloti 1021)
MTGKLLSIGECMVELMQAERDMLRKGYAGDTFNTAYYARLFLPADWTVDYFTAVGTDTVS
DELLAFIESTGVGTAHIRRIEGRTPGLYMIHLKDGERSFSYWRSTSAAKLLADDPDRLRA
AIEAANVVFFSGITLAILSPDAAETLLAELRRAKAGGRQVVFDPNIRPRLWDDAARMRAT
IEAGGRAATMVMPSFDDEATHFGDASVEATIERYRALGAENVAVKDGKNGVTLCFAGKER
VHVPASQVSAVVDTTSAGDSFNGSFLARLASGDSPADAAAFAARIAAAVIGHHGALIGRD
KLPRG