Protein Info for SMc01528 in Sinorhizobium meliloti 1021

Annotation: peptide ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 25 to 182 (158 residues), 84.1 bits, E=7.4e-28

Best Hits

Swiss-Prot: 45% identical to DPPD_BACSU: Dipeptide transport ATP-binding protein DppD (dppD) from Bacillus subtilis (strain 168)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to smk:Sinme_2457)

MetaCyc: 44% identical to dipeptide ABC transporter ATP binding subunit DppD (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

See Q92N29 at UniProt or InterPro

Protein Sequence (277 amino acids)

>SMc01528 peptide ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MSPLLTVEDLRVRFPTRTGVVEAVRGVSFTLGRERLGIVGESGSGKSQTGRAIMGLTPPH
AEVTAKRLAFEGIDLLSASPKLRRDLRGKRIAMILQDPKYSLNPVMSIGRQIVETLRRHE
KVGRAEARERALDMLAAVQIRDASRVFDLYPHEVSGGMGQRAMIAMMLVAGPELLIADEP
TSALDVTVQLEVLAILDKLVAERGMGLIFVSHDLRLVSSFCDRVLVMYAGRIVEEIAASE
LGNAKHPYTRGLLNCMPVIGADRHPLPVLDRKPEWAL