Protein Info for SMc01506 in Sinorhizobium meliloti 1021

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 14 to 160 (147 residues), 83.8 bits, see alignment E=5.2e-28 PF04542: Sigma70_r2" amino acids 16 to 78 (63 residues), 54.1 bits, see alignment E=2.2e-18 PF07638: Sigma70_ECF" amino acids 65 to 160 (96 residues), 31 bits, see alignment E=4.7e-11 PF08281: Sigma70_r4_2" amino acids 104 to 156 (53 residues), 62.8 bits, see alignment E=3.6e-21 PF04545: Sigma70_r4" amino acids 109 to 158 (50 residues), 33.1 bits, see alignment E=6.2e-12

Best Hits

Swiss-Prot: 62% identical to ECFG_RHOPT: ECF RNA polymerase sigma factor EcfG (ecfG) from Rhodopseudomonas palustris (strain TIE-1)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 99% identity to smd:Smed_2345)

Predicted SEED Role

"macromolecule metabolism; macromolecule synthesis, modification; rna synthesis, modification , dna transcription"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N11 at UniProt or InterPro

Protein Sequence (184 amino acids)

>SMc01506 RNA polymerase sigma factor (Sinorhizobium meliloti 1021)
MSSENQEFKREMLAALPSLRAFAMSLIGRHDRADDLVQDTIMKAWAKQDHFEIGTNMKAW
LFTILRNELYSQMRKRGREVQDSDGHLTETLAHHPEQYGSLDLQDFRRALEQLPPDQREA
IILVGASGFSYEEAATICGCALGTIKSRVNRARQRLQEILQVRGENDYGPDETSAPITSR
AFVS