Protein Info for SMc01503 in Sinorhizobium meliloti 1021

Annotation: sugar kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 PF00370: FGGY_N" amino acids 4 to 260 (257 residues), 102.1 bits, see alignment E=4e-33 TIGR01315: FGGY-family pentulose kinase" amino acids 5 to 522 (518 residues), 500 bits, see alignment E=4.3e-154 PF02782: FGGY_C" amino acids 277 to 475 (199 residues), 157.6 bits, see alignment E=3.8e-50

Best Hits

KEGG orthology group: K00924, [EC: 2.7.1.-] (inferred from 100% identity to sme:SMc01503)

Predicted SEED Role

"D-ribulokinase (EC 2.7.1.47)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 2.7.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N09 at UniProt or InterPro

Protein Sequence (527 amino acids)

>SMc01503 sugar kinase (Sinorhizobium meliloti 1021)
MRNYVVAVDIGTGSARAGVFDRRGKLLARADRTIAMNRPEENHAEHDSEDIWAAVCGAVR
SAREKAAVPAESIAAIGFDATCSLVVRDRDGAPLSVNRQGEARWDTIVWLDHRALAEADF
CTATKHPVLDHSGRVMSPEMEMPKLMWLKRNLPQQWERAGYFFDLADYMSWRSTGSTARS
RCTLTAKWNYLAHERRGWQQDYLEQIGLEDLLERGGLPEETLPVERAVGRLSASAAEELG
LDTGCQVAPGLIDAYAGALGVLGGFADAPAKLERQLALIGGTSSCIVAFSKDMKPGFGMW
GPYFEAVLPGLWLIEGGQSATGALLDHIVRLHGGGLPPTTETHAKIIERVQEMRAVHGAD
FAQRLHVLPDFHGNRSPLADPHALGVISGLPLDSSFDALCRLYWRTCVAIALGIRHILEM
MKEAGYELDTLHVTGGHVRNPLLMELYCDVTGCRVVAPQAPDAVLLGTAMTAAVAGELYP
DLASAGPAMSSAGTERLPDPALRRIYDRDYRRFLALYRHREELEAME