Protein Info for SMc01471 in Sinorhizobium meliloti 1021

Annotation: cytochrome C oxidase assembly factor transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details PF02630: SCO1-SenC" amino acids 40 to 176 (137 residues), 171.5 bits, see alignment E=4.5e-55

Best Hits

KEGG orthology group: K07152, (no description) (inferred from 100% identity to smk:Sinme_2132)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NN6 at UniProt or InterPro

Protein Sequence (199 amino acids)

>SMc01471 cytochrome C oxidase assembly factor transmembrane protein (Sinorhizobium meliloti 1021)
MKSIRIVLWVAILVMVAVLGWLTFDMTQPKQQAASGPFGVPFTLVAQNGEQITEKAFTGK
PTALFFGFTHCPEVCPTTLFELNGWLDKVDPEGNKLQAYFITVDPERDTPEVLGQYVSNV
SKRITGISGPPDKVLEMVKGYRVYYKKVPTDEAKPDGDYTMDHTASVFLLDANGQFSGTI
AYGENPETAVKKLENLTRG