Protein Info for SMc01469 in Sinorhizobium meliloti 1021

Annotation: methyl accepting chemotaxis transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 689 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 195 to 215 (21 residues), see Phobius details PF00672: HAMP" amino acids 222 to 263 (42 residues), 25 bits, see alignment 2e-09 PF00015: MCPsignal" amino acids 410 to 567 (158 residues), 158.2 bits, see alignment E=1.9e-50

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to smk:Sinme_2130)

Predicted SEED Role

"Methyl accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NN8 at UniProt or InterPro

Protein Sequence (689 amino acids)

>SMc01469 methyl accepting chemotaxis transmembrane protein (Sinorhizobium meliloti 1021)
MNTVPSAKGKLSVSLRLATLAGAAFLGFGSVLAVGLYEQGGSQEALDKAVIAQRGMGTLE
EMRLARLELVLAAMDTIVDRGERRIQPERAAQIGSSLEVIEGRQADLEALARLIGKPEVL
AGFESDMAQLRKAVEQDLKALVEAGAPAEEFARIDDVIDAAGERVGASLAQLADAAASLA
AGRIADVRTSGEHALMLQAAACLLAMATLIGLIWFHGNVLRRGILGLRDSMRRIHSGDLT
AEAAGLDRGDEIGEMARSVELFRVSAIEKRALKERARASRQETETERERHETEREQAIGL
INTAVEALGGALNQLADGNLAVAIREPFDGGLDALRRDFNDTVERLSQVLSSVKENTASI
ESNGRQMRSAADDLARRTEKQAASLEQTSAALEEITVTVKTATERAEEASHMVDETRINA
EESGRIVGEAIAAMARIEGASSEIGKIIDVIDEIAFQTNLLALNAGVEAARAGEAGKGFA
VVAQEVRELAQRAAGAAKDIKALVSRSGNEVKTGVRLVQETGDALGRIGAKVACINEHMS
SIVMAAREQSTGLREIDTAVAQLDQMTQQNAAMVEQTNAASHTLAQDAEKLSEIVGQFRH
GQARETAIRTAAIQPPGRAGSATASAPARAATATAAAPVSLRKPAAAQSSTRPAPSPAKA
LMGKLAGAFGNRPGSTPSVTASGENWEEF