Protein Info for SMc01468 in Sinorhizobium meliloti 1021

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 transmembrane" amino acids 49 to 68 (20 residues), see Phobius details PF01584: CheW" amino acids 13 to 148 (136 residues), 135.2 bits, see alignment E=6.1e-44

Best Hits

Swiss-Prot: 51% identical to CHEW_RHIME: Chemotaxis protein CheW (cheW) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03408, purine-binding chemotaxis protein CheW (inferred from 100% identity to sme:SMc01468)

Predicted SEED Role

"Positive regulator of CheA protein activity (CheW)" in subsystem Bacterial Chemotaxis or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G3XCP5 at UniProt or InterPro

Protein Sequence (154 amino acids)

>SMc01468 chemotaxis protein (Sinorhizobium meliloti 1021)
MSNAIKQSGAYLEIVSFHLGEQEFCIDIMAIREIRGWAPVTPMPHTPPYVLGLINLRGAV
IPVIDMACRLGMKMTEPSERSAIIVTDINGKLVGLLVEQVSDMMTIRSEDLQPAPEIIPE
AQRAFCRGIVALEKSMVCFLNLDTVIAEELAQAA