Protein Info for SMc01464 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 231 to 393 (163 residues), 124.7 bits, see alignment E=1.5e-40 PF00990: GGDEF" amino acids 234 to 389 (156 residues), 123.3 bits, see alignment E=4.3e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc01464)

Predicted SEED Role

"FIG01075173: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NP1 at UniProt or InterPro

Protein Sequence (426 amino acids)

>SMc01464 hypothetical protein (Sinorhizobium meliloti 1021)
MAETQAALYFSTTGRFEMSFLSAIPVIALLAMLPVLLSLRPVAGVREFSASCALSAASAG
ALTVAAALQAPVAAMFGYAGLAVSLFFVLQGLRRFLALSIPASLCLVLAFSSGVLGFIIA
LGGHDSPAAGMIVVAGVVAALLLVLGLAAADRWPGEKPAIQVVVVGSAAVVFTALAHALG
PSAHVLPGPAGSPASSLFDFLLVTMRVLCLPLLFLAMILTMQARVIAGLRAMIARDGLTG
ALSRGTLMEEGERIFAECVARQEPAAFLLLDLDFFKQINDQYGHACGDMALAHFADTVSA
FLAGRGVLGRIGGEEFGIVLPDHTEEQARALAEDICRVVRETPAGRSHQRIRLTVSIGIA
AAIAGETITDVMIRADLALYDSKADGRDRCSVARDRRIDASARALAAAAAQLREARAARS
ELRHSA